Lineage for d1fj8d2 (1fj8 D:254-404)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 28367Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 28368Species Escherichia coli [TaxId:562] [53908] (4 PDB entries)
  8. Domain d1fj8d2: 1fj8 D:254-404 [35955]

Details for d1fj8d2

PDB Entry: 1fj8 (more details), 2.27 Å

PDB Description: the structure of beta-ketoacyl-[acyl carrier protein] synthase i in complex with cerulenin, implications for drug design

SCOP Domain Sequences for d1fj8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj8d2 c.95.1.1 (D:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

SCOP Domain Coordinates for d1fj8d2 are not available.

Timeline for d1fj8d2:

Domains from same chain:
(mouse over for more information)
d1fj8d1
Domains from other chains:
(mouse over for more information)
d1fj8a1, d1fj8a2, d1fj8b1, d1fj8b2, d1fj8c1, d1fj8c2