Lineage for d6d0ba1 (6d0b A:239-348)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2534960Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
    contains PAC motif
  6. 2534964Protein automated matches [191006] (1 species)
    not a true protein
  7. 2534965Species Human (Homo sapiens) [TaxId:9606] [188753] (17 PDB entries)
  8. 3059481Domain d6d0ba1: 6d0b A:239-348 [359543]
    Other proteins in same PDB: d6d0ba2, d6d0bb_
    automated match to d5ufpa_
    complexed with fov

Details for d6d0ba1

PDB Entry: 6d0b (more details), 1.6 Å

PDB Description: crystal structure of pt1614 bound to hif2a-b*:arnt-b* complex
PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d6d0ba1:

Sequence, based on SEQRES records: (download)

>d6d0ba1 d.110.3.7 (A:239-348) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseie

Sequence, based on observed residues (ATOM records): (download)

>d6d0ba1 d.110.3.7 (A:239-348) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynppqcimcvnyvlseie

SCOPe Domain Coordinates for d6d0ba1:

Click to download the PDB-style file with coordinates for d6d0ba1.
(The format of our PDB-style files is described here.)

Timeline for d6d0ba1:

  • d6d0ba1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6d0ba2
View in 3D
Domains from other chains:
(mouse over for more information)
d6d0bb_