Lineage for d6cica_ (6cic A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560335Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2560336Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2560337Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2561135Protein automated matches [190421] (6 species)
    not a true protein
  7. 2561300Species Human (Homo sapiens) [TaxId:9606] [187302] (45 PDB entries)
  8. 3059451Domain d6cica_: 6cic A: [359513]
    automated match to d4ucha_
    complexed with 7r2, gol, h4b, hem, zn; mutant

Details for d6cica_

PDB Entry: 6cic (more details), 1.75 Å

PDB Description: structure of the human nitric oxide synthase r354a/g357d mutant heme domain in complex with n-(1-(2-(ethyl(methyl)amino)ethyl)-1,2,3,4- tetrahydroquino-lin-6-yl)thiophene-2-carboximidamide
PDB Compounds: (A:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d6cica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cica_ d.174.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
k

SCOPe Domain Coordinates for d6cica_:

Click to download the PDB-style file with coordinates for d6cica_.
(The format of our PDB-style files is described here.)

Timeline for d6cica_:

  • d6cica_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01