Lineage for d6cifb_ (6cif B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560335Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2560336Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2560337Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2560338Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2560533Species Human (Homo sapiens) [TaxId:9606] [56516] (22 PDB entries)
  8. 3059448Domain d6cifb_: 6cif B: [359510]
    automated match to d3e7sa_
    complexed with btb, cl, f2j, gd, gol, h4b, hem, zn

Details for d6cifb_

PDB Entry: 6cif (more details), 2.2 Å

PDB Description: structure of the human endothelial nitric oxide synthase heme domain in complex with n-(1-(piperidin-4-yl)indolin-5-yl)thiophene-2- carboximidamide
PDB Compounds: (B:) Nitric oxide synthase, endothelial

SCOPe Domain Sequences for d6cifb_:

Sequence, based on SEQRES records: (download)

>d6cifb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfprklqgrpspgppapeqllsq
ardfinqyyssikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvg
riqwgklqvfdardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatas
fmkhleneqkarggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw

Sequence, based on observed residues (ATOM records): (download)

>d6cifb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfprapeqllsqardfinqyyss
ikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfd
ardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqq
dgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevpleh
ptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphrynile
dvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqka
rggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw

SCOPe Domain Coordinates for d6cifb_:

Click to download the PDB-style file with coordinates for d6cifb_.
(The format of our PDB-style files is described here.)

Timeline for d6cifb_:

  • d6cifb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01