Lineage for d6bgtc2 (6bgt C:166-322)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3031041Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 3031042Protein automated matches [232407] (3 species)
    not a true protein
  7. 3031043Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)
  8. 3031067Domain d6bgtc2: 6bgt C:166-322 [359498]
    Other proteins in same PDB: d6bgta1, d6bgta2, d6bgtb_, d6bgtc1, d6bgtc3
    automated match to d1n8zc3
    complexed with nag; mutant

Details for d6bgtc2

PDB Entry: 6bgt (more details), 2.7 Å

PDB Description: structure of trastuzumab fab mutant in complex with her2 extracellular domain
PDB Compounds: (C:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d6bgtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bgtc2 g.3.9.0 (C:166-322) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg

SCOPe Domain Coordinates for d6bgtc2:

Click to download the PDB-style file with coordinates for d6bgtc2.
(The format of our PDB-style files is described here.)

Timeline for d6bgtc2: