Lineage for d6bfyc1 (6bfy C:0-139)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2515158Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2515159Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2515455Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2515456Protein automated matches [226922] (91 species)
    not a true protein
  7. 3059428Species Escherichia coli [TaxId:562] [359490] (2 PDB entries)
  8. 3059433Domain d6bfyc1: 6bfy C:0-139 [359495]
    Other proteins in same PDB: d6bfya2, d6bfya3, d6bfyb2, d6bfyb3, d6bfyc2, d6bfyc3, d6bfyd2, d6bfyd3, d6bfye2, d6bfye3, d6bfyf2, d6bfyf3
    automated match to d2fyma2
    complexed with 2pg, gol, mg, so4

Details for d6bfyc1

PDB Entry: 6bfy (more details), 1.81 Å

PDB Description: crystal structure of enolase from escherichia coli with bound 2- phosphoglycerate substrate
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d6bfyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfyc1 d.54.1.0 (C:0-139) automated matches {Escherichia coli [TaxId: 562]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

SCOPe Domain Coordinates for d6bfyc1:

Click to download the PDB-style file with coordinates for d6bfyc1.
(The format of our PDB-style files is described here.)

Timeline for d6bfyc1:

  • d6bfyc1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01