| Class g: Small proteins [56992] (100 folds) |
| Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
| Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
| Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries) Uniprot P15692 40-133 |
| Domain d6bftg_: 6bft G: [359489] Other proteins in same PDB: d6bftb1, d6bftb2, d6bftl1, d6bftl2 automated match to d4zffd_ complexed with mes, so4; mutant |
PDB Entry: 6bft (more details), 2.55 Å
SCOPe Domain Sequences for d6bftg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bftg_ g.17.1.1 (G:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk
Timeline for d6bftg_: