Lineage for d6a4sa1 (6a4s A:2-229)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2441326Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2441712Family c.23.16.4: Aspartyl dipeptidase PepE [52331] (2 proteins)
    probable circular permutation in the common core; contains a catalytic Ser-His-Glu triad
  6. 3059082Protein automated matches [359144] (1 species)
    not a true protein
  7. 3059083Species Salmonella typhimurium [TaxId:99287] [359145] (2 PDB entries)
  8. 3059426Domain d6a4sa1: 6a4s A:2-229 [359488]
    Other proteins in same PDB: d6a4sa2, d6a4sb2
    automated match to d1fyea_

Details for d6a4sa1

PDB Entry: 6a4s (more details), 1.9 Å

PDB Description: crystal structure of peptidase e with ordered active site loop from salmonella enterica
PDB Compounds: (A:) Peptidase E

SCOPe Domain Sequences for d6a4sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a4sa1 c.23.16.4 (A:2-229) automated matches {Salmonella typhimurium [TaxId: 99287]}
ellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlaplg
vnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigwsa
ganlacptirttndmpivdpngfdaldlfplqinphftnalpeghkgetreqrirellvv
apeltviglpegnwiqvsngqavlggpnttwvfkageeavaleaghrf

SCOPe Domain Coordinates for d6a4sa1:

Click to download the PDB-style file with coordinates for d6a4sa1.
(The format of our PDB-style files is described here.)

Timeline for d6a4sa1:

  • d6a4sa1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6a4sa2