Lineage for d5zgac_ (5zga C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2413579Protein automated matches [196175] (8 species)
    not a true protein
  7. 3059337Species Opisthorchis viverrini [TaxId:6198] [359399] (4 PDB entries)
  8. 3059409Domain d5zgac_: 5zga C: [359471]
    automated match to d1mo0b_
    mutant

Details for d5zgac_

PDB Entry: 5zga (more details), 1.79 Å

PDB Description: crystal structure of triosephosphate isomerase sad deletion and n115a mutant from opisthorchis viverrini
PDB Compounds: (C:) triosephosphate isomerase

SCOPe Domain Sequences for d5zgac_:

Sequence, based on SEQRES records: (download)

>d5zgac_ c.1.1.1 (C:) automated matches {Opisthorchis viverrini [TaxId: 6198]}
rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektahaisagvnv
iacigekleereagkteevcfrqmeairknlsmwnhiviayepvwaigtgktateqqaqe
vhlavrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfiei
cnana

Sequence, based on observed residues (ATOM records): (download)

>d5zgac_ c.1.1.1 (C:) automated matches {Opisthorchis viverrini [TaxId: 6198]}
rkffvggnwkmngskkendkliemlthakidpntevlvappalylpsvrekldkrfhvaa
qncykvpsgaftgevspamlkdvgcdwvilghserrhilletdqlvgektahaisagvnv
iacigekleereagkteevcfrqmeairknlsmwnhiviayepvwaktateqqaqevhla
vrrwmeekvspavaksiriiyggsvtaancrtlakqpdvdgflvggaslkpdfieicnan
a

SCOPe Domain Coordinates for d5zgac_:

Click to download the PDB-style file with coordinates for d5zgac_.
(The format of our PDB-style files is described here.)

Timeline for d5zgac_:

  • d5zgac_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25