SCOPe 2.08: Domain d5zi2a1: 5zi2 A:1-144

Lineage for d5zi2a1 (5zi2 A:1-144)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225295] (5 PDB entries)

8. Domain d5zi2a1: 5zi2 A:1-144 [359467]
   Other proteins in same PDB: d5zi2a2, d5zi2b2
   automated match to d1ib6a1
   complexed with adp, cl, gol, nad

Details for d5zi2a1

PDB Entry: 5zi2, 2 Å

PDB Description: mdh3 wild type, nad-form

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5zi2a1:

Sequence; same for both SEQRES and ATOM records:

>d5zi2a1 c.2.1.0 (A:1-144) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvkvailgasggvgqplslllklspyvselalydiraaegigkdlshintnsscvgydkd
sientlsnaqvvlipagvprkpgltrddlfkmnagivkslvtavgkfapnarilvisnpv
nslvpiavetlkkmgkfkpgnvmg

Timeline for d5zi2a1:

• d5zi2a1 first appeared in SCOPe 2.07