Lineage for d5ynha1 (5ynh A:29-162)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2364770Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2364909Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2364910Protein automated matches [254436] (5 species)
    not a true protein
  7. 3059309Species Klebsiella pneumoniae [TaxId:573] [359371] (7 PDB entries)
  8. 3059400Domain d5ynha1: 5ynh A:29-162 [359462]
    Other proteins in same PDB: d5ynha2, d5ynha3, d5ynha4, d5ynha5
    automated match to d2fhfa3
    complexed with ca, glc, gol

Details for d5ynha1

PDB Entry: 5ynh (more details), 2.05 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 10 mm gamma-cyclodextrin
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynha1 b.3.1.0 (A:29-162) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dpqdvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdal
sapvadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftd
rtvsviagnsavyd

SCOPe Domain Coordinates for d5ynha1:

Click to download the PDB-style file with coordinates for d5ynha1.
(The format of our PDB-style files is described here.)

Timeline for d5ynha1:

  • d5ynha1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25