Lineage for d5yoza_ (5yoz A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (142 species)
    not a true protein
  7. 3059396Species Leishmania donovani [TaxId:5661] [359458] (1 PDB entry)
  8. 3059397Domain d5yoza_: 5yoz A: [359459]
    automated match to d2atxb_

Details for d5yoza_

PDB Entry: 5yoz (more details)

PDB Description: solution structure of truncated rab5a from leishmania donovani
PDB Compounds: (A:) Rab5a

SCOPe Domain Sequences for d5yoza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yoza_ c.37.1.0 (A:) automated matches {Leishmania donovani [TaxId: 5661]}
mnthppqlmeatsakivmlgesgagkssialrftrneflanqettigaaflsktvmidgr
alkyeiwdtaglerfrslapiyyrgasgalvvyditnseslkkaqtwikelranadpsli
ivlvgnkkdlgslrqvsfedgqrlaaeeqlaafyeasakdnnnveqvfldlaakl

SCOPe Domain Coordinates for d5yoza_:

Click to download the PDB-style file with coordinates for d5yoza_.
(The format of our PDB-style files is described here.)

Timeline for d5yoza_:

  • d5yoza_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25