Lineage for d5yn2a2 (5yn2 A:163-287)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (57 species)
    not a true protein
  7. 3059311Species Klebsiella pneumoniae [TaxId:573] [359373] (7 PDB entries)
  8. 3059392Domain d5yn2a2: 5yn2 A:163-287 [359454]
    Other proteins in same PDB: d5yn2a1, d5yn2a4, d5yn2a5
    automated match to d2fhfa2
    complexed with ca, mg

Details for d5yn2a2

PDB Entry: 5yn2 (more details), 2.3 Å

PDB Description: crystal structure of apo pullulanase from klebsiella pneumoniae in space group p43212
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5yn2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yn2a2 b.1.18.0 (A:163-287) automated matches {Klebsiella pneumoniae [TaxId: 573]}
sradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvk
ltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtag
vlddt

SCOPe Domain Coordinates for d5yn2a2:

Click to download the PDB-style file with coordinates for d5yn2a2.
(The format of our PDB-style files is described here.)

Timeline for d5yn2a2:

  • d5yn2a2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25