SCOPe 2.08: Domain d5yz3b2: 5yz3 B:244-428

Lineage for d5yz3b2 (5yz3 B:244-428)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d5yz3b2: 5yz3 B:244-428 [359450]
   Other proteins in same PDB: d5yz3a1, d5yz3b1, d5yz3c1, d5yz3d1, d5yz3e_, d5yz3f1, d5yz3f2, d5yz3f3
   automated match to d3rycd2
   complexed with 94u, acp, ca, cl, gdp, gol, gtp, mes, mg, na

Details for d5yz3b2

PDB Entry: 5yz3, 2.55 Å

PDB Description: crystal structure of t2r-ttl-28 complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5yz3b2:

Sequence; same for both SEQRES and ATOM records:

>d5yz3b2 d.79.2.1 (B:244-428) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Timeline for d5yz3b2:

• d5yz3b2 first appeared in SCOPe 2.07