Lineage for d5ylwa_ (5ylw A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (79 species)
    not a true protein
  7. 3059385Species Salvia miltiorrhiza [TaxId:226208] [359447] (2 PDB entries)
  8. 3059386Domain d5ylwa_: 5ylw A: [359448]
    automated match to d3k9va_
    complexed with hem, mn

Details for d5ylwa_

PDB Entry: 5ylw (more details), 1.7 Å

PDB Description: cyp76ah1 from salvia miltiorrhiza
PDB Compounds: (A:) Ferruginol synthase

SCOPe Domain Sequences for d5ylwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ylwa_ a.104.1.0 (A:) automated matches {Salvia miltiorrhiza [TaxId: 226208]}
lppgpfpypivgnmlqlganphqvfaklskrygplmsihlgslytvivsspemakeilhr
hgqvfsgrtiaqavhacdhdkismgflpvasewrdmrkickeqmfsnqsmeasqglrrqk
lqqlldhvqkcsdsgravdireaafittlnlmsatlfssqatefdskatmefkeiiegva
tivgvpnfadyfpilrpfdpqgvkrradvffgkllakiegylnerleskranpnapkkdd
fleivvdiiqanefklkthhfthlmldlfvggsdtnttsiewamselvmnpdkmarlkae
lksvagdekivdesampklpylqavikevmrihppgplllprkaesdqevngylipkgtq
ilinayaigrdpsiwtdpetfdperfldnkidfkgqdyellpfgsgrrvcpgmplatril
hmatatlvhnfdwkleddstaaadhagelfgvavrravplriipiv

SCOPe Domain Coordinates for d5ylwa_:

Click to download the PDB-style file with coordinates for d5ylwa_.
(The format of our PDB-style files is described here.)

Timeline for d5ylwa_:

  • d5ylwa_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25