Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Psychrobacter arcticus [TaxId:259536] [338566] (12 PDB entries) |
Domain d6fu7c_: 6fu7 C: [359446] automated match to d5m8hf_ complexed with cl, mg, prt, trs |
PDB Entry: 6fu7 (more details), 2.31 Å
SCOPe Domain Sequences for d6fu7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fu7c_ c.94.1.0 (C:) automated matches {Psychrobacter arcticus [TaxId: 259536]} lgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvptyv ehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvnv arayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvssr livnqvsykrkfallepildsfknsi
Timeline for d6fu7c_: