Lineage for d6fuac_ (6fua C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (147 species)
    not a true protein
  7. 2488023Species Psychrobacter arcticus [TaxId:259536] [338566] (11 PDB entries)
  8. 3059377Domain d6fuac_: 6fua C: [359439]
    automated match to d5m8hf_
    complexed with adp, cl, mg, prp

Details for d6fuac_

PDB Entry: 6fua (more details), 2.8 Å

PDB Description: atp phosphoribosyltransferase (hiszg atpprt) from psychrobacter arcticus in complex with prpp and adp
PDB Compounds: (C:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d6fuac_:

Sequence, based on SEQRES records: (download)

>d6fuac_ c.94.1.0 (C:) automated matches {Psychrobacter arcticus [TaxId: 259536]}
flgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpty
vehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvn
varayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvss
rlivnqvsykrkfallepildsfknsi

Sequence, based on observed residues (ATOM records): (download)

>d6fuac_ c.94.1.0 (C:) automated matches {Psychrobacter arcticus [TaxId: 259536]}
flgltlalskgrileetmpllraagvelledpeaslifptsnpnvrvlilrasdvptyve
hgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvnva
rayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvssrl
ivnqvsykrkfallepildsfknsi

SCOPe Domain Coordinates for d6fuac_:

Click to download the PDB-style file with coordinates for d6fuac_.
(The format of our PDB-style files is described here.)

Timeline for d6fuac_:

  • d6fuac_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25