Lineage for d5ynda5 (5ynd A:966-1083)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (38 species)
    not a true protein
  7. 3059316Species Klebsiella pneumoniae [TaxId:573] [359378] (7 PDB entries)
  8. 3059359Domain d5ynda5: 5ynd A:966-1083 [359421]
    Other proteins in same PDB: d5ynda1, d5ynda2, d5ynda3, d5ynda4
    automated match to d2fhfa4
    complexed with ca, glc, gol, peg

Details for d5ynda5

PDB Entry: 5ynd (more details), 2.23 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 1 mm gamma-cyclodextrin
PDB Compounds: (A:) DUF3372 domain-containing protein

SCOPe Domain Sequences for d5ynda5:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynda5 b.71.1.0 (A:966-1083) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

SCOPe Domain Coordinates for d5ynda5:

Click to download the PDB-style file with coordinates for d5ynda5.
(The format of our PDB-style files is described here.)

Timeline for d5ynda5:

  • d5ynda5 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25