Lineage for d5ynda1 (5ynd A:29-162)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2364770Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2364909Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2364910Protein automated matches [254436] (5 species)
    not a true protein
  7. 3059309Species Klebsiella pneumoniae [TaxId:573] [359371] (7 PDB entries)
  8. 3059355Domain d5ynda1: 5ynd A:29-162 [359417]
    Other proteins in same PDB: d5ynda2, d5ynda3, d5ynda4, d5ynda5
    automated match to d2fhfa3
    complexed with ca, glc, gol, peg

Details for d5ynda1

PDB Entry: 5ynd (more details), 2.23 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 1 mm gamma-cyclodextrin
PDB Compounds: (A:) DUF3372 domain-containing protein

SCOPe Domain Sequences for d5ynda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynda1 b.3.1.0 (A:29-162) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dpqdvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdal
sapvadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftd
rtvsviagnsavyd

SCOPe Domain Coordinates for d5ynda1:

Click to download the PDB-style file with coordinates for d5ynda1.
(The format of our PDB-style files is described here.)

Timeline for d5ynda1:

  • d5ynda1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25