Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [359378] (10 PDB entries) |
Domain d5ynea5: 5yne A:966-1083 [359416] Other proteins in same PDB: d5ynea1, d5ynea2, d5ynea3, d5ynea4 automated match to d2fhfa4 complexed with ca, gol, peg |
PDB Entry: 5yne (more details), 2.2 Å
SCOPe Domain Sequences for d5ynea5:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ynea5 b.71.1.0 (A:966-1083) automated matches {Klebsiella pneumoniae [TaxId: 573]} dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk
Timeline for d5ynea5:
View in 3D Domains from same chain: (mouse over for more information) d5ynea1, d5ynea2, d5ynea3, d5ynea4 |