SCOPe 2.08: Domain d5ynea1: 5yne A:30-162

Lineage for d5ynea1 (5yne A:30-162)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.0: automated matches [254199] (1 protein)
   not a true family

6. Protein automated matches [254436] (5 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [359371] (9 PDB entries)

8. Domain d5ynea1: 5yne A:30-162 [359412]
   Other proteins in same PDB: d5ynea2, d5ynea3, d5ynea4, d5ynea5
   automated match to d2fhfa3
   complexed with ca, gol, peg

Details for d5ynea1

PDB Entry: 5yne, 2.2 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 10 mm alpha-cyclodextrin

PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynea1:

Sequence; same for both SEQRES and ATOM records:

>d5ynea1 b.3.1.0 (A:30-162) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pqdvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdals
apvadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdr
tvsviagnsavyd

Timeline for d5ynea1:

• d5ynea1 first appeared in SCOPe 2.07