SCOPe 2.06: Domain d1fj4a2: 1fj4 A:254-404

Lineage for d1fj4a2 (1fj4 A:254-404)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.1: Thiolase-related [53902] (10 proteins)
Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
Species Escherichia coli [TaxId:562] [53908] (19 PDB entries)
Uniprot P14926
Domain d1fj4a2: 1fj4 A:254-404 [35941]
complexed with tlm

Details for d1fj4a2

PDB Entry: 1fj4 (more details), 2.35 Å

PDB Description: the structure of beta-ketoacyl-[acyl carrier protein] synthase i in complex with thiolactomycin, implications for drug design

PDB Compounds: (A:) beta-ketoacyl-[acyl carrier protein] synthase I

SCOPe Domain Sequences for d1fj4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj4a2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

SCOPe Domain Coordinates for d1fj4a2:

Click to download the PDB-style file with coordinates for d1fj4a2.
(The format of our PDB-style files is described here.)

Timeline for d1fj4a2: