Lineage for d5zi3b1 (5zi3 B:1-144)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846158Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225295] (5 PDB entries)
  8. 2846167Domain d5zi3b1: 5zi3 B:1-144 [359403]
    Other proteins in same PDB: d5zi3a2, d5zi3b2
    automated match to d1ib6a1
    complexed with gol

Details for d5zi3b1

PDB Entry: 5zi3 (more details), 2.1 Å

PDB Description: mdh3 wild type, apo-form
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d5zi3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zi3b1 c.2.1.0 (B:1-144) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvkvailgasggvgqplslllklspyvselalydiraaegigkdlshintnsscvgydkd
sientlsnaqvvlipagvprkpgltrddlfkmnagivkslvtavgkfapnarilvisnpv
nslvpiavetlkkmgkfkpgnvmg

SCOPe Domain Coordinates for d5zi3b1:

Click to download the PDB-style file with coordinates for d5zi3b1.
(The format of our PDB-style files is described here.)

Timeline for d5zi3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zi3b2