Lineage for d5yz3f2 (5yz3 F:77-378)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541719Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2541720Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2541721Species Chicken (Gallus gallus) [TaxId:9031] [311385] (77 PDB entries)
  8. 3059333Domain d5yz3f2: 5yz3 F:77-378 [359395]
    Other proteins in same PDB: d5yz3a1, d5yz3a2, d5yz3b1, d5yz3b2, d5yz3c1, d5yz3c2, d5yz3d1, d5yz3d2, d5yz3e_, d5yz3f1, d5yz3f3
    automated match to d3tiia2
    complexed with 94u, acp, ca, cl, gdp, gol, gtp, mes, mg, na

Details for d5yz3f2

PDB Entry: 5yz3 (more details), 2.55 Å

PDB Description: crystal structure of t2r-ttl-28 complex
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5yz3f2:

Sequence, based on SEQRES records: (download)

>d5yz3f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5yz3f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwialisseasel
ldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepyn
sanfqdktchltnhciqknygryeegnemffeefnqylmdalnttlensillqikhiirs
clmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdv
aissvfplatsifikl

SCOPe Domain Coordinates for d5yz3f2:

Click to download the PDB-style file with coordinates for d5yz3f2.
(The format of our PDB-style files is described here.)

Timeline for d5yz3f2:

  • d5yz3f2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25