Lineage for d5ynaa5 (5yna A:966-1083)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (37 species)
    not a true protein
  7. 3059316Species Klebsiella pneumoniae [TaxId:573] [359378] (7 PDB entries)
  8. 3059325Domain d5ynaa5: 5yna A:966-1083 [359387]
    Other proteins in same PDB: d5ynaa1, d5ynaa2, d5ynaa3, d5ynaa4
    automated match to d2fhfa4
    complexed with act, ca, glc, gol, peg

Details for d5ynaa5

PDB Entry: 5yna (more details), 1.96 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 1 mm alpha-cyclodextrin
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynaa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynaa5 b.71.1.0 (A:966-1083) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

SCOPe Domain Coordinates for d5ynaa5:

Click to download the PDB-style file with coordinates for d5ynaa5.
(The format of our PDB-style files is described here.)

Timeline for d5ynaa5:

  • d5ynaa5 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25