Lineage for d5ynaa3 (5yna A:288-402)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (62 species)
    not a true protein
  7. 3059311Species Klebsiella pneumoniae [TaxId:573] [359373] (7 PDB entries)
  8. 3059323Domain d5ynaa3: 5yna A:288-402 [359385]
    Other proteins in same PDB: d5ynaa1, d5ynaa4, d5ynaa5
    automated match to d2fhfa1
    complexed with act, ca, glc, gol, peg

Details for d5ynaa3

PDB Entry: 5yna (more details), 1.96 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 1 mm alpha-cyclodextrin
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynaa3 b.1.18.0 (A:288-402) automated matches {Klebsiella pneumoniae [TaxId: 573]}
yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq
ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk

SCOPe Domain Coordinates for d5ynaa3:

Click to download the PDB-style file with coordinates for d5ynaa3.
(The format of our PDB-style files is described here.)

Timeline for d5ynaa3:

  • d5ynaa3 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25