Lineage for d5ynaa1 (5yna A:29-162)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2364770Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2364909Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2364910Protein automated matches [254436] (5 species)
    not a true protein
  7. 3059309Species Klebsiella pneumoniae [TaxId:573] [359371] (7 PDB entries)
  8. 3059321Domain d5ynaa1: 5yna A:29-162 [359383]
    Other proteins in same PDB: d5ynaa2, d5ynaa3, d5ynaa4, d5ynaa5
    automated match to d2fhfa3
    complexed with act, ca, glc, gol, peg

Details for d5ynaa1

PDB Entry: 5yna (more details), 1.96 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 1 mm alpha-cyclodextrin
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5ynaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynaa1 b.3.1.0 (A:29-162) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dpqdvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdal
sapvadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftd
rtvsviagnsavyd

SCOPe Domain Coordinates for d5ynaa1:

Click to download the PDB-style file with coordinates for d5ynaa1.
(The format of our PDB-style files is described here.)

Timeline for d5ynaa1:

  • d5ynaa1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25