Lineage for d5yn7a4 (5yn7 A:403-965)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2416559Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2417057Protein automated matches [190099] (29 species)
    not a true protein
  7. 3059314Species Klebsiella pneumoniae [TaxId:573] [359376] (7 PDB entries)
  8. 3059315Domain d5yn7a4: 5yn7 A:403-965 [359377]
    Other proteins in same PDB: d5yn7a1, d5yn7a2, d5yn7a3, d5yn7a5
    automated match to d2fhfa5
    complexed with ca, edo, glc

Details for d5yn7a4

PDB Entry: 5yn7 (more details), 2.59 Å

PDB Description: crystal structure of pullulanase from klebsiella pneumoniae complex at 0.1 mm beta-cyclodextrin
PDB Compounds: (A:) PulA protein

SCOPe Domain Sequences for d5yn7a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yn7a4 c.1.8.1 (A:403-965) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pegwdgltmphaqktkadlakmtiheshirdlsawdqtvpaelrgkylaltaqesnmvqh
lkqlsasgvthiellpvfdlatvnefsdkvadiqqpfsrlcevnsavkssefagycdsgs
tveevltqlkqndskdnpqvqalntlvaqtdsynwgydpfhytvpegsyatdpegtarik
efrtmiqaikqdlgmnvimdvvynhtnaagptdrtsvldkivpwyyqrlnettgsvesat
ccsdsapehrmfakliadslavwttdykidgfrfdlmlyhpkaqilsawerikalnpdiy
ffgegwdsnqsdrfeiasqinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqgvgsga
gvlpnelttlsddqarhladltrlgmagnladfvlidkdgavkrgseidyngapggyaad
ptevvnyvskhdnqtlwdmisykaaqeadldtrvrmqavslatvmlgqgiafdqqgsell
rsksftrdsydsgdwfnrvdyslqdnnynvgmprssddgsnydiiarvkdavatpgetel
kqmtafyqeltalrkssplftlg

SCOPe Domain Coordinates for d5yn7a4:

Click to download the PDB-style file with coordinates for d5yn7a4.
(The format of our PDB-style files is described here.)

Timeline for d5yn7a4:

  • d5yn7a4 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25