SCOPe 2.08: Domain d5ykja1: 5ykj A:49-260

Lineage for d5ykja1 (5ykj A:49-260)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [195631] (7 PDB entries)

8. Domain d5ykja1: 5ykj A:49-260 [359366]
   Other proteins in same PDB: d5ykja2
   automated match to d1prxa_
   complexed with gol, na

Details for d5ykja1

PDB Entry: 5ykj, 1.53 Å

PDB Description: structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems

PDB Compounds: (A:) Peroxiredoxin PRX1, mitochondrial

SCOPe Domain Sequences for d5ykja1:

Sequence; same for both SEQRES and ATOM records:

>d5ykja1 c.47.1.0 (A:49-260) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lrinsdapnfdadttvgkinfydylgdswgvlfshpadftpvcttevsafaklkpefdkr
nvkliglsvedveshekwiqdikeiakvknvgfpiigdtfrnvaflydmvdaegfknind
gslktvrsvfvidpkkkirliftypstvgrntsevlrvidalqltdkegvvtpinwqpad
dviippsvsndeakakfgqfneikpylrftks

Timeline for d5ykja1:

• d5ykja1 first appeared in SCOPe 2.07