Lineage for d5ykja1 (5ykj A:49-260)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (177 species)
    not a true protein
  7. 2457716Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [195631] (6 PDB entries)
  8. 3059304Domain d5ykja1: 5ykj A:49-260 [359366]
    Other proteins in same PDB: d5ykja2
    automated match to d1prxa_
    complexed with gol, na

Details for d5ykja1

PDB Entry: 5ykj (more details), 1.53 Å

PDB Description: structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems
PDB Compounds: (A:) Peroxiredoxin PRX1, mitochondrial

SCOPe Domain Sequences for d5ykja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ykja1 c.47.1.0 (A:49-260) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lrinsdapnfdadttvgkinfydylgdswgvlfshpadftpvcttevsafaklkpefdkr
nvkliglsvedveshekwiqdikeiakvknvgfpiigdtfrnvaflydmvdaegfknind
gslktvrsvfvidpkkkirliftypstvgrntsevlrvidalqltdkegvvtpinwqpad
dviippsvsndeakakfgqfneikpylrftks

SCOPe Domain Coordinates for d5ykja1:

Click to download the PDB-style file with coordinates for d5ykja1.
(The format of our PDB-style files is described here.)

Timeline for d5ykja1:

  • d5ykja1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25

View in 3D
Domains from same chain:
(mouse over for more information)
d5ykja2