Lineage for d5ylgb_ (5ylg B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499110Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2499111Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2499120Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2499121Protein automated matches [234001] (5 species)
    not a true protein
  7. 2499137Species Pteris ryukyuensis [TaxId:367335] [346349] (2 PDB entries)
  8. 3059300Domain d5ylgb_: 5ylg B: [359362]
    automated match to d4pxvc_
    complexed with edo, zn

Details for d5ylgb_

PDB Entry: 5ylg (more details), 1.48 Å

PDB Description: crystal structure of lysm domain from pteris ryukyuensis chitinase a
PDB Compounds: (B:) chitinase a

SCOPe Domain Sequences for d5ylgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ylgb_ d.7.1.0 (B:) automated matches {Pteris ryukyuensis [TaxId: 367335]}
ttytiksgdtcyaisqargislsdfeswnagidcnnlqigqvvcvsk

SCOPe Domain Coordinates for d5ylgb_:

Click to download the PDB-style file with coordinates for d5ylgb_.
(The format of our PDB-style files is described here.)

Timeline for d5ylgb_:

  • d5ylgb_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25