Lineage for d5t2qa1 (5t2q A:5-63)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585872Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2585873Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2585874Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2585973Protein automated matches [227085] (1 species)
    not a true protein
  7. 2585974Species Human (Homo sapiens) [TaxId:9606] [226417] (4 PDB entries)
  8. 3059297Domain d5t2qa1: 5t2q A:5-63 [359359]
    automated match to d4rsul1

Details for d5t2qa1

PDB Entry: 5t2q (more details), 1.9 Å

PDB Description: unliganded human hvem at 1.9a in p 1 21 1
PDB Compounds: (A:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d5t2qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2qa1 g.24.1.1 (A:5-63) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

SCOPe Domain Coordinates for d5t2qa1:

Click to download the PDB-style file with coordinates for d5t2qa1.
(The format of our PDB-style files is described here.)

Timeline for d5t2qa1:

  • d5t2qa1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25

View in 3D
Domains from same chain:
(mouse over for more information)
d5t2qa2