Lineage for d5t2rb1 (5t2r B:6-63)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585872Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2585873Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2585874Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2585973Protein automated matches [227085] (1 species)
    not a true protein
  7. 2585974Species Human (Homo sapiens) [TaxId:9606] [226417] (4 PDB entries)
  8. 3059288Domain d5t2rb1: 5t2r B:6-63 [359350]
    Other proteins in same PDB: d5t2ra3
    automated match to d4rsul1

Details for d5t2rb1

PDB Entry: 5t2r (more details), 2.1 Å

PDB Description: unliganded human hvem at 2.1a in p 21 21 21
PDB Compounds: (B:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d5t2rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2rb1 g.24.1.1 (B:6-63) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

SCOPe Domain Coordinates for d5t2rb1:

Click to download the PDB-style file with coordinates for d5t2rb1.
(The format of our PDB-style files is described here.)

Timeline for d5t2rb1:

  • d5t2rb1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25