Lineage for d1dd8b2 (1dd8 B:254-406)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 28367Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 28368Species Escherichia coli [TaxId:562] [53908] (4 PDB entries)
  8. 28372Domain d1dd8b2: 1dd8 B:254-406 [35935]

Details for d1dd8b2

PDB Entry: 1dd8 (more details), 2.3 Å

PDB Description: crystal structure of beta-ketoacyl-[acyl carrier protein] synthase i from escherichia coli

SCOP Domain Sequences for d1dd8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd8b2 c.95.1.1 (B:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOP Domain Coordinates for d1dd8b2:

Click to download the PDB-style file with coordinates for d1dd8b2.
(The format of our PDB-style files is described here.)

Timeline for d1dd8b2: