Lineage for d5nb0c1 (5nb0 C:4-114)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 3059270Domain d5nb0c1: 5nb0 C:4-114 [359332]
    automated match to d1li1a1
    complexed with cl

Details for d5nb0c1

PDB Entry: 5nb0 (more details), 2.7 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha3nc1
PDB Compounds: (C:) Collagen alpha-3(IV) chain

SCOPe Domain Sequences for d5nb0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nb0c1 d.169.1.0 (C:4-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpfl
fcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegp

SCOPe Domain Coordinates for d5nb0c1:

Click to download the PDB-style file with coordinates for d5nb0c1.
(The format of our PDB-style files is described here.)

Timeline for d5nb0c1:

  • d5nb0c1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25