Lineage for d6mgrd1 (6mgr D:1-481)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415584Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2415631Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2415632Protein automated matches [227084] (15 species)
    not a true protein
  7. 2415713Species Campylobacter jejuni [TaxId:192222] [235705] (4 PDB entries)
  8. 3059256Domain d6mgrd1: 6mgr D:1-481 [359318]
    Other proteins in same PDB: d6mgrb2, d6mgrc2, d6mgrd2
    automated match to d4mz8b_
    complexed with cl, jqs, k, mpd, so4

Details for d6mgrd1

PDB Entry: 6mgr (more details), 1.97 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor oxanosine monophosphate
PDB Compounds: (D:) inosine monophosphate dehydrogenase

SCOPe Domain Sequences for d6mgrd1:

Sequence, based on SEQRES records: (download)

>d6mgrd1 c.1.5.0 (D:1-481) automated matches {Campylobacter jejuni [TaxId: 192222]}
mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm
arlgglgvihknmdiasqvrevkrvkksesggikdlkkrkeypdankdnfgrlrvgaaig
vgqmdrvdalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakal
ceagvdavkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdi
akalavgassvmigsllagtdespgelftyqgrqyksyrgmgslgamqkgssdryfqqgt
aqdklvpegiegrvpyvgsirsvvhqllgglrssmgyvgakdiedfqkraefveittagl
keshvhdvtitheapnyk

Sequence, based on observed residues (ATOM records): (download)

>d6mgrd1 c.1.5.0 (D:1-481) automated matches {Campylobacter jejuni [TaxId: 192222]}
mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm
arlgglgvihknmdiasqvrevkrvkksekkrkeypdankdnfgrlrvgaaigvgqmdrv
dalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvda
vkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavg
assvmigsllagtdespgelftyqgrqyksyrgmgslgamqyfqklvpegiegrvpyvgs
irsvvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk

SCOPe Domain Coordinates for d6mgrd1:

Click to download the PDB-style file with coordinates for d6mgrd1.
(The format of our PDB-style files is described here.)

Timeline for d6mgrd1:

  • d6mgrd1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25