Lineage for d6e7ds_ (6e7d S:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (16 species)
    not a true protein
  7. 2559977Species Mouse (Mus musculus) [TaxId:10090] [187331] (22 PDB entries)
  8. 3059253Domain d6e7ds_: 6e7d S: [359315]
    Other proteins in same PDB: d6e7da2, d6e7dc2, d6e7dd2, d6e7dg2, d6e7di2, d6e7dk2, d6e7dm2, d6e7do2
    automated match to d1yxja_
    complexed with nag, so4

Details for d6e7ds_

PDB Entry: 6e7d (more details), 2.9 Å

PDB Description: structure of the inhibitory nkr-p1b receptor bound to the host-encoded ligand, clr-b
PDB Compounds: (S:) Killer cell lectin-like receptor subfamily B member 1B allele B

SCOPe Domain Sequences for d6e7ds_:

Sequence, based on SEQRES records: (download)

>d6e7ds_ d.169.1.0 (S:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
sfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdnrwic
qkeln

Sequence, based on observed residues (ATOM records): (download)

>d6e7ds_ d.169.1.0 (S:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
sfwiglsytltdmnwkwingtafnsditgvtengscaaisgekvtsegcssdnrwicqke
ln

SCOPe Domain Coordinates for d6e7ds_:

Click to download the PDB-style file with coordinates for d6e7ds_.
(The format of our PDB-style files is described here.)

Timeline for d6e7ds_:

  • d6e7ds_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25