Lineage for d6mn2b_ (6mn2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923433Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2923434Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2923450Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2923451Protein automated matches [190957] (7 species)
    not a true protein
  7. 2923498Species Uncultured bacterium [TaxId:77133] [314779] (5 PDB entries)
  8. 2923510Domain d6mn2b_: 6mn2 B: [359311]
    automated match to d5ht0c_
    complexed with cl, coa, peg, sis, so4; mutant

Details for d6mn2b_

PDB Entry: 6mn2 (more details), 2.74 Å

PDB Description: crystal structure of meta-aac0038, an environmental aminoglycoside resistance enzyme, mutant h168a in abortive complex with sisomicin- coa
PDB Compounds: (B:) Aminoglycoside N(3)-acetyltransferase

SCOPe Domain Sequences for d6mn2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mn2b_ c.140.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
srvstrsslaedlraigladgdavlvhaalrkvgkivggpddildamrdvigpagtvlgy
adwqledeirddpamrehipafdplrsrsirdngfwpelirttpgalrsaspgasmaaig
geaewftadhaldygygprsplgklveakgkvlmlgapldtmtllahaehladfpnkril
ryeapilvdgekvwrwfeefdtsdppdgladdyfagiveeflatgrgkrgkigeassvlv
padeivafavdwlerwgrt

SCOPe Domain Coordinates for d6mn2b_:

Click to download the PDB-style file with coordinates for d6mn2b_.
(The format of our PDB-style files is described here.)

Timeline for d6mn2b_: