SCOP 1.55: Domain d1dlvd2: 1dlv D:269-392

Lineage for d1dlvd2 (1dlv D:269-392)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
4. Superfamily c.95.1: Thiolase-like [53901] (2 families)
5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)

6. Protein Biosynthetic thiolase [53905] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [53906] (3 PDB entries)

8. Domain d1dlvd2: 1dlv D:269-392 [35931]

Details for d1dlvd2

PDB Entry: 1dlv, 2.29 Å

PDB Description: biosynthetic thiolase from zoogloea ramigera in complex with coa

SCOP Domain Sequences for d1dlvd2:

Sequence; same for both SEQRES and ATOM records:

>d1dlvd2 c.95.1.1 (D:269-392) Biosynthetic thiolase {Zoogloea ramigera}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

Timeline for d1dlvd2:

• d1dlvd2 appears in SCOP 1.57
  
• d1dlvd2 appears in the current release, SCOPe 2.08