Lineage for d6mn0c_ (6mn0 C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2494336Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2494337Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2494353Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2494354Protein automated matches [190957] (5 species)
    not a true protein
  7. 2494382Species Uncultured bacterium [TaxId:77133] [314779] (4 PDB entries)
  8. 3059247Domain d6mn0c_: 6mn0 C: [359309]
    automated match to d5ht0c_
    complexed with aco, cl, gol, pe3, so4; mutant

Details for d6mn0c_

PDB Entry: 6mn0 (more details), 2.4 Å

PDB Description: crystal structure of meta-aac0038, an environmental aminoglycoside resistance enzyme, h168a mutant in complex with acetyl-coa
PDB Compounds: (C:) Aminoglycoside N(3)-acetyltransferase

SCOPe Domain Sequences for d6mn0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mn0c_ c.140.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
ssrvstrsslaedlraigladgdavlvhaalrkvgkivggpddildamrdvigpagtvlg
yadwqledeirddpamrehipafdplrsrsirdngfwpelirttpgalrsaspgasmaai
ggeaewftadhaldygygprsplgklveakgkvlmlgapldtmtllahaehladfpnkri
lryeapilvdgekvwrwfeefdtsdppdgladdyfagiveeflatgrgkrgkigeassvl
vpadeivafavdwlerwgrta

SCOPe Domain Coordinates for d6mn0c_:

Click to download the PDB-style file with coordinates for d6mn0c_.
(The format of our PDB-style files is described here.)

Timeline for d6mn0c_:

  • d6mn0c_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25