Lineage for d6g61a_ (6g61 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (174 species)
    not a true protein
  7. 2458773Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (28 PDB entries)
  8. 3059244Domain d6g61a_: 6g61 A: [359306]
    automated match to d4i8ba_

Details for d6g61a_

PDB Entry: 6g61 (more details), 1.8 Å

PDB Description: crystal structure of thioredoxin o1 from arabidopsis thaliana in oxidized state
PDB Compounds: (A:) Thioredoxin O1, mitochondrial

SCOPe Domain Sequences for d6g61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g61a_ c.47.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ngvvlvkseeefinamskaqdgslpsvfyftaawcgpcrfispvivelskqypdvttykv
dideggisntisklnitavptlhffkggskkgevvgadvtklknlmeqlyk

SCOPe Domain Coordinates for d6g61a_:

Click to download the PDB-style file with coordinates for d6g61a_.
(The format of our PDB-style files is described here.)

Timeline for d6g61a_:

  • d6g61a_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25