Lineage for d6fmoc_ (6fmo C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (78 species)
    not a true protein
  7. 2332286Species Trypanosoma cruzi [TaxId:5693] [196511] (20 PDB entries)
  8. 3059243Domain d6fmoc_: 6fmo C: [359305]
    automated match to d4uhia_
    complexed with dve, hem; mutant

Details for d6fmoc_

PDB Entry: 6fmo (more details), 3.18 Å

PDB Description: crystal structure of the substrate (obtusifoliol)-bound and ligand- free i105f mutant of sterol 14-alpha demethylase (cyp51) from trypanosoma cruzi
PDB Compounds: (C:) sterol 14alpha-demethylase

SCOPe Domain Sequences for d6fmoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmoc_ a.104.1.0 (C:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
lppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrff
sprneilsprevytfmtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhev
rkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslip
aavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavy
rdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaql
nydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhd
eeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrd
evpdpdyhtmvvgptlnqclvkytrkkk

SCOPe Domain Coordinates for d6fmoc_:

Click to download the PDB-style file with coordinates for d6fmoc_.
(The format of our PDB-style files is described here.)

Timeline for d6fmoc_:

  • d6fmoc_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25