Lineage for d6hosa_ (6hos A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2413091Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2413092Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2413160Family b.179.1.0: automated matches [254312] (1 protein)
    not a true family
  6. 2413161Protein automated matches [254716] (2 species)
    not a true protein
  7. 3059232Species Komagataella pastoris [TaxId:4922] [359294] (1 PDB entry)
  8. 3059242Domain d6hosa_: 6hos A: [359304]
    automated match to d4lhka_
    complexed with ca, gol, mg, p33, pg4

Details for d6hosa_

PDB Entry: 6hos (more details), 2.15 Å

PDB Description: structure of the kpflo2 adhesin domain in complex with glycerol
PDB Compounds: (A:) ba75_04148t0

SCOPe Domain Sequences for d6hosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hosa_ b.179.1.0 (A:) automated matches {Komagataella pastoris [TaxId: 4922]}
sdsayacdidatrydgfnatiyefqpgdgrltrdpvfmstgylnrtqlhsitgvtdpgfs
iytpgvptttlygipnvnwenlllelkgyfraevsgdyglslrniddsailffgketafq
ccnensisneastdyslftifrqegdettnldsftytqyleagkyypvrtffvnierhav
fnftmtlpdgteltdfhnyiyqfgaldeeqcqa

SCOPe Domain Coordinates for d6hosa_:

Click to download the PDB-style file with coordinates for d6hosa_.
(The format of our PDB-style files is described here.)

Timeline for d6hosa_:

  • d6hosa_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25