Lineage for d6hd4a1 (6hd4 A:248-529)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542346Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 2542360Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries)
  8. 3059234Domain d6hd4a1: 6hd4 A:248-529 [359296]
    Other proteins in same PDB: d6hd4a2, d6hd4b2
    automated match to d1m52b_
    complexed with cl, fyw, gol, sti

Details for d6hd4a1

PDB Entry: 6hd4 (more details), 2.03 Å

PDB Description: abl1 in complex with compound 7 and imatinib (sti-571)
PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d6hd4a1:

Sequence, based on SEQRES records: (download)

>d6hd4a1 d.144.1.7 (A:248-529) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekel

Sequence, based on observed residues (ATOM records): (download)

>d6hd4a1 d.144.1.7 (A:248-529) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedmeveeflkeaav
mkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqiss
ameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtape
slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy
elmracwqwnpsdrpsfaeihqafetmfqessisdevekel

SCOPe Domain Coordinates for d6hd4a1:

Click to download the PDB-style file with coordinates for d6hd4a1.
(The format of our PDB-style files is described here.)

Timeline for d6hd4a1:

  • d6hd4a1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25

View in 3D
Domains from same chain:
(mouse over for more information)
d6hd4a2