Lineage for d6h7kc1 (6h7k C:6-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356240Domain d6h7kc1: 6h7k C:6-120 [359283]
    Other proteins in same PDB: d6h7kc2, d6h7kd2
    automated match to d5da4a_
    complexed with 2cv, fvn, na

Details for d6h7kc1

PDB Entry: 6h7k (more details), 2.7 Å

PDB Description: activated turkey beta1 adrenoceptor with bound agonist formoterol and nanobody nb80
PDB Compounds: (C:) Camelid antibody fragment Nb80

SCOPe Domain Sequences for d6h7kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7kc1 b.1.1.1 (C:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgsifsintmgwyrqapgkqrelvaaihsggstnyansvkg
rftisrdnaantvylqmnslkpedtavyycnvkdygavlyeydywgqgtqvtvss

SCOPe Domain Coordinates for d6h7kc1:

Click to download the PDB-style file with coordinates for d6h7kc1.
(The format of our PDB-style files is described here.)

Timeline for d6h7kc1:

  • d6h7kc1 is new in SCOPe 2.07-stable
  • d6h7kc1 does not appear in SCOPe 2.08

View in 3D
Domains from same chain:
(mouse over for more information)
d6h7kc2