Lineage for d6gbla_ (6gbl A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2419732Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2419733Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species)
  7. 2419751Species Brevundimonas diminuta [TaxId:293] [193602] (6 PDB entries)
  8. 3059213Domain d6gbla_: 6gbl A: [359275]
    automated match to d1p6bb_
    complexed with cac, edo, fmt, zn

Details for d6gbla_

PDB Entry: 6gbl (more details), 1.95 Å

PDB Description: repertoires of functionally diverse enzymes through computational design at epistatic active-site positions
PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d6gbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gbla_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Brevundimonas diminuta [TaxId: 293]}
drintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrraraag
vrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdgeqqad
ifesegldpsrvcighsddtddldyltalaargyligldgipwsaiglednasaaallgl
rswqtrallikalidqgyadqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpdetletimvdnparflsptl

SCOPe Domain Coordinates for d6gbla_:

Click to download the PDB-style file with coordinates for d6gbla_.
(The format of our PDB-style files is described here.)

Timeline for d6gbla_:

  • d6gbla_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25