Lineage for d6gbka_ (6gbk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2419732Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2419733Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species)
  7. 2419767Species Pseudomonas diminuta [TaxId:293] [51566] (25 PDB entries)
    Uniprot P0A434 30-365
  8. 3059208Domain d6gbka_: 6gbk A: [359270]
    automated match to d1qw7a_
    complexed with fmt, trs, zn

Details for d6gbka_

PDB Entry: 6gbk (more details), 1.9 Å

PDB Description: repertoires of functionally diverse enzymes through computational design at epistatic active-site positions
PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d6gbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gbka_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrraraag
vrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdgeqqad
ifesegldpsrvcighsddtddldyltalaargyligldgiphsaiglednasaaallgl
rswqtrallikalidqgyadqilvsndwlfgfssyvtnimdvldrvnpdgmafiplrvip
flrekgvpdetletimvdnparflspt

SCOPe Domain Coordinates for d6gbka_:

Click to download the PDB-style file with coordinates for d6gbka_.
(The format of our PDB-style files is described here.)

Timeline for d6gbka_:

  • d6gbka_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25