SCOPe 2.08: Domain d6gblb_: 6gbl B:

Lineage for d6gblb_ (6gbl B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)

7. Species Brevundimonas diminuta [TaxId:293] [193602] (6 PDB entries)

8. Domain d6gblb_: 6gbl B: [359269]
   automated match to d1p6bb_
   complexed with cac, edo, fmt, zn

Details for d6gblb_

PDB Entry: 6gbl, 1.95 Å

PDB Description: repertoires of functionally diverse enzymes through computational design at epistatic active-site positions

PDB Compounds: (B:) Parathion hydrolase

SCOPe Domain Sequences for d6gblb_:

Sequence; same for both SEQRES and ATOM records:

>d6gblb_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Brevundimonas diminuta [TaxId: 293]}
drintvrgpitiseagftlmhehicgssagflrawpeffgsrdalaekavrglrraraag
vrtivdvstfdlgrdvellaevseaadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqervlraaaraslatgvpvtthtdasqrdgeqqad
ifesegldpsrvcighsddtddldyltalaargyligldgipwsaiglednasaaallgl
rswqtrallikalidqgyadqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpdetletimvdnparflspt

Timeline for d6gblb_:

• d6gblb_ first appeared in SCOPe 2.07