Lineage for d6fmob_ (6fmo B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (78 species)
    not a true protein
  7. 2332286Species Trypanosoma cruzi [TaxId:5693] [196511] (20 PDB entries)
  8. 3059203Domain d6fmob_: 6fmo B: [359265]
    automated match to d4uhia_
    complexed with dve, hem; mutant

Details for d6fmob_

PDB Entry: 6fmo (more details), 3.18 Å

PDB Description: crystal structure of the substrate (obtusifoliol)-bound and ligand- free i105f mutant of sterol 14-alpha demethylase (cyp51) from trypanosoma cruzi
PDB Compounds: (B:) sterol 14alpha-demethylase

SCOPe Domain Sequences for d6fmob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmob_ a.104.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
lppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrff
sprneilsprevytfmtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhev
rkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslip
aavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavy
rdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaql
nydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhd
eeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrd
evpdpdyhtmvvgptlnqclvkytrkkk

SCOPe Domain Coordinates for d6fmob_:

Click to download the PDB-style file with coordinates for d6fmob_.
(The format of our PDB-style files is described here.)

Timeline for d6fmob_:

  • d6fmob_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25