Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [53071] (7 PDB entries) |
Domain d6fhkb2: 6fhk B:189-381 [359263] automated match to d1s3xa2 complexed with adp, k, mg, po4, sep |
PDB Entry: 6fhk (more details), 1.66 Å
SCOPe Domain Sequences for d6fhkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fhkb2 c.55.1.1 (B:189-381) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]} gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea vaygaavqaailm
Timeline for d6fhkb2: