SCOPe 2.08: Domain d6fhkb2: 6fhk B:189-381

Lineage for d6fhkb2 (6fhk B:189-381)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53071] (7 PDB entries)

8. Domain d6fhkb2: 6fhk B:189-381 [359263]
   automated match to d1s3xa2
   complexed with adp, k, mg, po4, sep

Details for d6fhkb2

PDB Entry: 6fhk, 1.66 Å

PDB Description: structure of a modified protein containing a genetically encoded phosphoserine

PDB Compounds: (B:) heat shock 70 kda protein 1a

SCOPe Domain Sequences for d6fhkb2:

Sequence; same for both SEQRES and ATOM records:

>d6fhkb2 c.55.1.1 (B:189-381) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk
hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea
vaygaavqaailm

Timeline for d6fhkb2:

• d6fhkb2 first appeared in SCOPe 2.07