Lineage for d6flab2 (6fla B:112-216)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (529 PDB entries)
  8. 3059199Domain d6flab2: 6fla B:112-216 [359261]
    Other proteins in same PDB: d6flab1, d6flag_, d6flai_, d6flal1
    automated match to d1tqbc2
    complexed with cl, gol

Details for d6flab2

PDB Entry: 6fla (more details), 2.9 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 1
PDB Compounds: (B:) Light Chain of 3H5

SCOPe Domain Sequences for d6flab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flab2 b.1.1.2 (B:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d6flab2:

Click to download the PDB-style file with coordinates for d6flab2.
(The format of our PDB-style files is described here.)

Timeline for d6flab2:

  • d6flab2 appears in periodic updates to SCOPe 2.07 starting on 2018-10-25